¿Cuánto vale capitalcitychimneyservices.click?
Más acciones
Estimación analítica de datos | Estadísticas Diarias estimadas | |
|---|---|
Visitantes únicos al día |
2 |
Vista de páginas diarias |
7 |
Ingresos diarios de Anuncios |
$ 0.02 |
| Estimación de estadísticas mensuales | |
|---|---|
Visitantes únicos mensuales |
72 |
Páginas vistas mensuales |
207 |
Ingresos de Anuncios Mensuales |
$ 0.62 |
| Estadísticas anuales estimadas | |
|---|---|
Visitantes Únicos anuales |
889 |
Páginas vistas anuales |
2,557 |
Renta de Anuncios anuales |
$ 7.67 |
Información básica | Nombre de dominio | capitalcitychimneyservices.click |
| Título |
Chimney Sweeping Austin | Call 512-355-6865 |
| Palabras clave |
chimney sweeping Austin, chimney sweep, chimney cleaning, Austin TX |
| Descripción |
Need professional chimney sweeping in Austin? Call Capital City Chimney Services at 512-355-6865 for fast, reliable service you can trust. |
Estadísticas de Busqueda
Google Índice |
0 |
Índice Yahoo |
0 |
Índice Bing |
0 |
Google Backlinks (Ligas devueltas) |
0 |
Estadísticas Facebook | Compartir conteo | 0 |
| Recuento de comentarios | 0 |
| Los comentarios cuentan en el plugin | 0 |
| Conteo de reacción | 0 |
| Conteo total | 0 |
Estadísticas Antivirus
Google |
|
Norton |
|
Estadísticas Sociales
Pins |
1 |
Estadísticas de Ubicación | Dirección IP | 216.198.79.1 |
| País |
Estados Unidos
|
| Región | Georgia |
| Ciudad | Atlanta |
| Longitud | -84.3791 |
| Latitud | 33.8541 |
Domain Name: capitalcitychimneyservices.click
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6505851961
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: asa.ns.cloudflare.com
Name Server: zeus.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-02-11T17:04:48.555Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6505851961
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: asa.ns.cloudflare.com
Name Server: zeus.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-02-11T17:04:48.555Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Mostrar a tus visitantes el Valor de tu Sitio Web
Valor estimado
• $ 26.40 •
• $ 26.40 •
Dueño de un Sitio Web? Sitio Web en Venta!
Check Your Site Value
Estimar costo de cualquier Sitio Web y Dominio.
454,955 Total de Sitios Web que se ha calculado su precio.

Visitantes únicos al día
Vista de páginas diarias
Ingresos diarios de Anuncios
Google Índice
Índice Yahoo
Índice Bing
Google Backlinks (Ligas devueltas) 
Norton
Pins
WHOIS