Сколько стоит capitalcitychimneyservices.click?
Действия
Предполагаемые аналитические данные | Предполагаемая дневная статистика | |
|---|---|
Ежедневные уникальные посетители |
2 |
Ежедневный просмотр страниц |
7 |
Ежедневный доход с рекламы |
$ 0.02 |
| Предполагаемая месячная статистика | |
|---|---|
Ежемесячные уникальные посетители |
72 |
Ежемесячный просмотр страниц |
207 |
Ежемесячный доход с рекламы |
$ 0.62 |
| Предполагаемая годовая статистика | |
|---|---|
Ежегодные уникальные посетители |
889 |
Ежегодный просмотр страниц |
2,557 |
Ежегодный доход с рекламы |
$ 7.67 |
Основная информация | Доменное имя | capitalcitychimneyservices.click |
| Заголовок |
Chimney Sweeping Austin | Call 512-355-6865 |
| Ключевые слова |
chimney sweeping Austin, chimney sweep, chimney cleaning, Austin TX |
| Описание |
Need professional chimney sweeping in Austin? Call Capital City Chimney Services at 512-355-6865 for fast, reliable service you can trust. |
Поисковая Статистика
Google Индекс |
0 |
Yahoo Индекс |
0 |
Bing Индекс |
0 |
Количество обратный ссылок в Google |
0 |
Статистика Facebook | Количество шарингов | 0 |
| Количество комментариев | 0 |
| Количество комментариев в плагине | 0 |
| Количество реакций | 0 |
| Общее количество | 0 |
Статистика Антивирусов
Google |
|
Norton |
|
Социальная Статистика
Pins |
1 |
Статистика Местоположения | IP Адрес | 216.198.79.1 |
| Страна |
США
|
| Регион | Georgia |
| Город | Atlanta |
| Долгота | -84.3791 |
| Широта | 33.8541 |
Domain Name: capitalcitychimneyservices.click
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6505851961
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: asa.ns.cloudflare.com
Name Server: zeus.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-02-11T17:04:48.555Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6505851961
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: asa.ns.cloudflare.com
Name Server: zeus.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-02-11T17:04:48.555Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Покажите Своим посетителям сколько стоит Ваш Веб-сайт
Примерная стоимость
• $ 26.40 •
• $ 26.40 •
Владелец веб-сайта? Продать Веб-сайт!
Check Your Site Value
Ориентировочная стоимость любого домена.
Оценено 454,954 веб-сайта(-ов).

Ежедневные уникальные посетители
Ежедневный просмотр страниц
Ежедневный доход с рекламы
Google Индекс
Yahoo Индекс
Bing Индекс
Количество обратный ссылок в Google 
Norton
Pins
WHOIS