Hoeveel is capitalcitychimneyservices.click waard?
capitalcitychimneyservices.click
Heeft een geschatte waarde van
$ 26.40
Site prijs berekend op: 30 juli 2026 18:18:00
Meer akties
Geschatte data gegevens | Geschatte dagelijkse statistieken | |
|---|---|
Dagelijks unieke bezoekers |
2 |
Dagelijkse pagina bezoeken |
7 |
Dagelijkse advertentie verdiensten |
$ 0.02 |
| Geschatte maand statistieken | |
|---|---|
Unieke bezoekers per maand |
72 |
Maandelijkse pagina views |
207 |
Maandelijkse advertenties inkomsten |
$ 0.62 |
| Geschatte jaarlijkse statistieken | |
|---|---|
Jaarlijkse unieke bezoekers |
889 |
Jaarlijkse pagina views |
2,557 |
Jaarlijkse advertenties inkomsten |
$ 7.67 |
Basisinformatie | Domein naam | capitalcitychimneyservices.click |
| Titel |
Chimney Sweeping Austin | Call 512-355-6865 |
| Trefwoorden |
chimney sweeping Austin, chimney sweep, chimney cleaning, Austin TX |
| Beschrijving |
Need professional chimney sweeping in Austin? Call Capital City Chimney Services at 512-355-6865 for fast, reliable service you can trust. |
Search Engine statistieken
Google Index |
0 |
Yahoo Index |
0 |
Bing Index |
0 |
Google backlinks |
0 |
Facebook statistieken | Hoeveel is de website gedeeld | 0 |
| Aantal opmerkingen | 0 |
| Reacties tellen in de plugin | 0 |
| Reactie tellen | 0 |
| Totaal aantal | 0 |
Antivirus Stats
Google |
|
Norton |
|
Social Media statistieken
Pins |
1 |
Locatie statistieken | IP Adres | 216.198.79.1 |
| Land |
US
|
| Regio | Georgia |
| Stad | Atlanta |
| Lengte | -84.3791 |
| Breedte | 33.8541 |
Domain Name: capitalcitychimneyservices.click
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: zeus.ns.cloudflare.com
Name Server: asa.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-07-30T23:18:00.486Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: zeus.ns.cloudflare.com
Name Server: asa.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-07-30T23:18:00.486Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Check Your Site Value
Geschatte website waarde van elk domein
454,968 totaal websites prijs berekend.

Dagelijks unieke bezoekers
Dagelijkse pagina bezoeken
Dagelijkse advertentie verdiensten
Google Index
Yahoo Index
Bing Index
Google backlinks 
Norton
Pins
WHOIS