Quanto vale il sito web capitalcitychimneyservices.click?
Più azioni
Dati Stimati Analytics | Statistiche Stimate Giornaliere | |
|---|---|
Visite Uniche Giornaliere |
2 |
Visualizzazioni Pagina Giornaliere |
7 |
Reddito Ads Giornaliero |
$ 0.02 |
| Statistiche Stimate Mensili | |
|---|---|
Visitatori Unici Mensili |
72 |
Visualizzazioni pagina Mensili |
207 |
Reddito Ads Mensile |
$ 0.62 |
| Statistiche Stimate Annuali | |
|---|---|
Visitatori Unici Annuali |
889 |
Visualizzazioni Pagina Annuali |
2,557 |
Reddito Ads Annuale |
$ 7.67 |
Informazioni di Base | Nome Dominio | capitalcitychimneyservices.click |
| Titolo |
Chimney Sweeping Austin | Call 512-355-6865 |
| Parole chiave |
chimney sweeping Austin, chimney sweep, chimney cleaning, Austin TX |
| Descrizione |
Need professional chimney sweeping in Austin? Call Capital City Chimney Services at 512-355-6865 for fast, reliable service you can trust. |
Statistiche Motori di Ricerca
Indice Google |
0 |
Indice Yahoo |
0 |
Indice Bing |
0 |
Backlink di Google |
0 |
Statistiche Facebook | Conteggio Condivisioni | 0 |
| Conto commenti | 0 |
| Commenti contano nel plugin | 0 |
| Conteggio delle reazioni | 0 |
| Conteggio Totale | 0 |
Statistiche Antivirus
Google |
|
Norton |
|
Statistiche Social
Pins |
1 |
Statistiche Posizione | Indirizzo IP | 216.198.79.1 |
| Paese |
Stati Uniti d'America
|
| Regione | Georgia |
| Città | Atlanta |
| Longitudine | -84.3791 |
| Latitudine | 33.8541 |
Domain Name: capitalcitychimneyservices.click
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6505851961
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: asa.ns.cloudflare.com
Name Server: zeus.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-02-11T17:04:48.555Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Registry Domain ID: DO_34c30ca3b7a71ae0858b07d1eaa02263-UR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: www.dynadot.com
Updated Date: 2025-10-26T11:09:59.969Z
Creation Date: 2025-10-12T09:55:49.819Z
Registry Expiry Date: 2026-10-12T09:55:49.819Z
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6505851961
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: asa.ns.cloudflare.com
Name Server: zeus.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf
>>> Last update of WHOIS database: 2026-02-11T17:04:48.555Z <<<
For more information on domain status codes, please visit https://icann.org/epp
The WHOIS information provided in this page has been redacted
in compliance with ICANN's Temporary Specification for gTLD
Registration Data.
The data in this record is provided by Tucows Registry for informational
purposes only, and it does not guarantee its accuracy. Tucows Registry is
authoritative for whois information in top-level domains it operates
under contract with the Internet Corporation for Assigned Names and
Numbers. Whois information from other top-level domains is provided by
a third-party under license to Tucows Registry.
This service is intended only for query-based access. By using this
service, you agree that you will use any data presented only for lawful
purposes and that, under no circumstances will you use (a) data
acquired for the purpose of allowing, enabling, or otherwise supporting
the transmission by e-mail, telephone, facsimile or other
communications mechanism of mass unsolicited, commercial advertising
or solicitations to entities other than your existing customers; or
(b) this service to enable high volume, automated, electronic processes
that send queries or data to the systems of any Registrar or any
Registry except as reasonably necessary to register domain names or
modify existing domain name registrations.
Tucows Registry reserves the right to modify these terms at any time. By
submitting this query, you agree to abide by this policy. All rights
reserved.
Mostra ai Tuoi Visitatori il Valore del Tuo Sito Web
Valore Stimato
• $ 26.40 •
• $ 26.40 •
Proprietario del Sito? Vendita Sito Web!
Check Your Site Value
Stima costo di qualsiasi dominio di un sito web
In totale abbiamo calcolato il prezzo di 454,955 siti web

Visite Uniche Giornaliere
Visualizzazioni Pagina Giornaliere
Reddito Ads Giornaliero
Indice Google
Indice Yahoo
Indice Bing
Backlink di Google 
Norton
Pins
WHOIS